PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn375941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 1015aa    MW: 111121 Da    PI: 5.081
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn375941genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.82.1e-28612663152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek++ l++l++yFs+++kdAAk++gvc+T+LKriCRq+GI RWP+Rki+++
  Achn375941 612 AEKHVGLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGILRWPSRKINKV 663
                 58999*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.347602683IPR003035RWP-RK domain
PfamPF020423.7E-25616663IPR003035RWP-RK domain
SuperFamilySSF542775.23E-22906998No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-24911993No hitNo description
PROSITE profilePS5174520.199914996IPR000270PB1 domain
SMARTSM006668.1E-24914996IPR000270PB1 domain
PfamPF005642.0E-18915994IPR000270PB1 domain
CDDcd064073.51E-30915995No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1015 aa     Download sequence    Send to blast
MFSGGALTFT IALVRRNFFL LLKMEYPFSS KEKGGYWASP RGQMEGGDSS EDPFNNVVEL  60
MNFDMYSGWC SSPTTADPMF AAYAFSPLQS MPLTSYVPFD ALNFNEQDNA LFPEPDGDVG  120
GSSCGGGDNM VFQHMNTQFG FPMDSSGWDD PGTRKGTGSF QQNVTGNSLV PRPLAQTLAE  180
KMLRVLSLFK ESSGGGILAQ VWVPIKNGDR YILSTCEQPY LLDQMLAGYR EVSREYTFSA  240
EEKQGSFPGL PGRVFISKLP EWTSNVVYYN EAEYLRVQHA VHHEVRGSVA LPIFEDDPLE  300
ISCCAVLELV TMKEQPNFDV EMENVCRALQ AVNLRSTAPP KLYAQYLSKN QRAALAEITD  360
VLRAVCHAHR LPLALTWIPC CYNEGVGNDI SRLCVKGGNA SLSEKCILCI EDTACYVNDR  420
EMQEFVHACA EHYLKEGQGI SGKALQSNHP FFFPDVKSYA ISDYPLVQHA RKFGLTAAVA  480
IRLRSTFTGD DDYILEFFLP VNMKGSTEQQ LLLNNLSGTM QRISKSLRTV SDAELVGTKG  540
SNVEFQKGSL PNFAPVAISG INSQQTLDSS LNYIDQMPPD AFDPRTVLSE PDGPREQMSG  600
SRRLMEKKRS TAEKHVGLSV LQQYFSGSLK DAAKSIGVCP TTLKRICRQH GILRWPSRKI  660
NKVNRSLRKI QTVLDSVQGV EGGLKFDPTT GGLVAAGSII QEFDTGGTIL FPNKNASLKK  720
PESVSQDAPS VCPISCTDTE NSTVKLEEET YMDGNQAGLP RSLFMPNTYK GGNDSKIALT  780
DCCDDSKSAA LDAGKLGPVS LDTGAWTCSE DASLSSFFGK QGCKSLNKSS LKLENSDSHF  840
FSRSSDETDT GMDGDMGMRA DDGVIEHNQP PSSGMTDSSN GAGSAMHDSS SSSPSFGERR  900
HSKTQMSSGD SGSKISVKAT YKEDTVRFKF EPSLGCNQLY EEVAKRFKLH TGTFQLKYLD  960
DEQEWVMLVS DSELQECLEI LDFVGTRSVK FLIRDLPCAT GSSGSSNCFL AAST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007033848.10.0Plant regulator RWP-RK family protein, putative isoform 1
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A061ER470.0A0A061ER47_THECC; Plant regulator RWP-RK family protein, putative isoform 1
STRINGPGSC0003DMT4000341880.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein